PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A00200.1.p
Common NameEUGRSUZ_A00200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 395aa    MW: 43578.5 Da    PI: 6.2015
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A00200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rgrWT+eEde+l ++++ +G g+W++ ++  g+ R++k+c++rw +yl
  Eucgr.A00200.1.p 14 RGRWTAEEDEILTNYIQAHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                      8*******************************99************97 PP

2Myb_DNA-binding34.45.2e-1167118148
                       TSSS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ T+eE++l+v++++ lG++        k+ a +++ gRt++++k++w+++l
  Eucgr.A00200.1.p  67 RGNITAEEEKLIVQLHATLGNRgfygvrGIKS-AGHLP-GRTDNEIKNYWNSHL 118
                       7999*********************9998888.9****.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129421.295965IPR017930Myb domain
SuperFamilySSF466891.2E-2311114IPR009057Homeodomain-like
SMARTSM007175.5E-131363IPR001005SANT/Myb domain
PfamPF002496.3E-151461IPR001005SANT/Myb domain
CDDcd001671.70E-91661No hitNo description
Gene3DG3DSA:1.10.10.601.7E-1765122IPR009057Homeodomain-like
PROSITE profilePS5129411.52966122IPR017930Myb domain
SMARTSM007173.7E-666120IPR001005SANT/Myb domain
PfamPF002493.5E-867118IPR001005SANT/Myb domain
CDDcd001672.28E-671118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDEILTNYIQ AHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRSDLKRGNI TAEEEKLIVQ LHATLGNRGF YGVRGIKSAG HLPGRTDNEI KNYWNSHLSR  120
KIYVARPSTS TRVEPSLPTP MNAVKIAGTG KRRGRTSRSS MRKSSFTSMP PERPNHSTVP  180
KSEKGKEAQA PIKGQVGGSQ VMSSEPSWVP SKKTAAQESN KDVVHGSRID TDAGLNNEVA  240
AEAEGLFLGP CEWVDREIMR LNCMLHIEDA GALKLEGENG VVGRFEESEN EFAVMEKLMP  300
VTEETESSIW SSKSNAESST GEWYVSSSSM NNNKYNNDSG FDEWFDWDWA GGVGCSDNQW  360
ENEDKTLSWL CDSGNGEAEN ASDSTAAIKS ETIM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-201212225128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A00200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052493.10.0PREDICTED: transcription factor MYB12
TrEMBLA0A059DBM80.0A0A059DBM8_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s15090.13e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.16e-68myb domain protein 12